General Information

  • ID:  hor006527
  • Uniprot ID:  P08163(124-159)
  • Protein name:  Glycoprotein
  • Gene name:  NA
  • Organism:  Bufo japonicus (Japanese toad)
  • Family:  Vasopressin/oxytocin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bufo (genus), Bufonidae (family), Hyloidea (superfamily), Neobatrachia (suborder), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005185 neurohypophyseal hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  VTPEQNMTQMDGSASDLLLRLMHMANRQQQSKHQFY
  • Length:  36(124-159)
  • Propeptide:  TAPVPACFLCLLALSSACYIQNCPRGGKRSYPDTAVRQCIPCGPGNRGNCFGPNICCGEDLGCYVGTPETLRCVEETYLPSPCEAGGKPCSSGGRCAAPGVCCSDDTCVVDSSCLDEDSERRRVTPEQNMTQMDGSASDLLLRLMHMANRQQQSKHQFY
  • Signal peptide:  TAPVPACFLCLLALSSA
  • Modification:  NA
  • Glycosylation:  T6 N-linked (GlcNAc...) asparagine
  • Mutagenesis:  NA

Activity

  • Function:  Vasotocin is an antidiuretic hormone.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P08163-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006527_AF2.pdbhor006527_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 486028 Formula: C178H285N55O57S4
Absent amino acids: CIW Common amino acids: Q
pI: 7.71 Basic residues: 5
Polar residues: 9 Hydrophobic residues: 8
Hydrophobicity: -87.5 Boman Index: -9030
Half-Life: 100 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 56.94
Instability Index: 7455.28 Extinction Coefficient cystines: 1490
Absorbance 280nm: 42.57

Literature

  • PubMed ID:  3033676
  • Title:  Cloning and sequence analysis of cDNAs for neurohypophysial hormones vasotocin and mesotocin for the hypothalamus of toad, Bufo japonicus.